Softbuff Mac & amp; Descarga del controlador de ordenador

  • 2021-12-31Fecha de colección
  • 2022-02-15Actualizado
Softbuff Mac & amp; Descarga del controlador de ordenador
  • Dirección web:www.softbuff.com
  • Servidor IP:138.201.126.22
  • Descripción del lugar:Land Commission and; Descarga del controlador de ordenador

nombre de dominio:www.softbuff.comValuación

acerca de 5000~500000

nombre de dominio:www.softbuff.comfluir

546

nombre de dominio:www.softbuff.comBueno o malo

Tranquilidad de espíritu. naturaleza auspiciosa auspicioso

sitio web:Softbuff Mac & amp; Descarga del controlador de ordenadorPesos

2

sitio web:Softbuff Mac & amp; Descarga del controlador de ordenadorIP

138.201.126.22

sitio web:Softbuff Mac & amp; Descarga del controlador de ordenadorcontenido

SoftBuff-Mac&PC-DriversDownloads {"@context":":\/\/schema.org","@graph":[{"@type":"BreadcrumbList","@id":":\/\/softbuff.com\/#breadcrumblist","itemListElement":[{"@type":"ListItem","@id":":\/\/softbuff.com\/#listItem","position":1,"name":"Home"}]},{"@type":"CollectionPe","@id":":\/\/softbuff.com\/#collectionpe","url":":\/\/softbuff.com\/","name":"SoftBuff-Mac&PC-DriversDownloads","description":"Mac&PC-DriversDownloads","inLangue":"en-NZ","isPartOf":{"@id":":\/\/softbuff.com\/#website"},"breadcrumb":{"@id":":\/\/softbuff.com\/#breadcrumblist"},"about":{"@id":":\/\/softbuff.com\/#organization"}},{"@type":"Organization","@id":":\/\/softbuff.com\/#organization","name":"SoftBuff","url":":\/\/softbuff.com\/","sameAs":[":\/\/\/SoftBuff\/"]},{"@type":"WebSite","@id":":\/\/softbuff.com\/#website","url":":\/\/softbuff.com\/","name":"SoftBuff","description":"Mac&PC-DriversDownloads","inLangue":"en-NZ","publisher":{"@id":":\/\/softbuff.com\/#organization"},"potentialAction":{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":":\/\/softbuff.com\/?s={search_term_string}"},"query-input":"requiredname=search_term_string"}}]} img.wp-smiley,img.emoji{ display:inline!important; border:none!important; box-shadow:none!important; height:1em!important; width:1em!important; margin:00.07em!important; vertical-align:-0.1em!important; background:none!important; padding:0!important; }.has-text-align-justify{text-align:justify;}.jetpack-sharing-buttons__services-list{display:flex;flex-direction:row;flex-wrap:wrap;gap:0;list-style-type:none;margin:5px;padding:0}.jetpack-sharing-buttons__services-list.has-small-icon-size{font-size:12px}.jetpack-sharing-buttons__services-list.has-normal-icon-size{font-size:16px}.jetpack-sharing-buttons__services-list.has-large-icon-size{font-size:24px}.jetpack-sharing-buttons__services-list.has-huge-icon-size{font-size:36px}@mediaprint{.jetpack-sharing-buttons__services-list{display:none!important}}ul.jetpack-sharing-buttons__services-list.has-background{padding:1.25em2.375em}/*!Thisfileisauto-generated*/.wp-block-button__link{color:#fff;background-color:#c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em+2px)calc(1.333em+2px);font-size:1.125em}.wp-block-file__button{background:#c;color:#fff;text-decoration:none}body{--wp--preset--color--black:#;--wp--preset--color--cyan-bluish-gray:#abb8c3;--wp--preset--color--white:#ffffff;--wp--preset--color--pale-pink:#f78da7;--wp--preset--color--vivid-red:#cf2e2e;--wp--preset--color--luminous-vivid-orange:#ff6900;--wp--preset--color--luminous-vivid-amber:#fcb900;--wp--preset--color--light-green-cyan:#7bdcb5;--wp--preset--color--vivid-green-cyan:#00d084;--wp--preset--color--pale-cyan-blue:#8ed1fc;--wp--preset--color--vivid-cyan-blue:#0693e3;--wp--preset--color--vivid-purple:#9b51e0;--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple:linear-gradient(135deg,rgba(6,147,227,1)0%,rgb(155,81,224)100%);--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan:linear-gradient(135deg,rgb(122,220,180)0%,rgb(0,208,130)100%);--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange:linear-gradient(135deg,rgba(252,185,0,1)0%,rgba(255,105,0,1)100%);--wp--preset--gradient--luminous-vivid-orange-to-vivid-red:linear-gradient(135deg,rgba(255,105,0,1)0%,rgb(207,46,46)100%);--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray:linear-gradient(135deg,rgb(238,238,238)0%,rgb(169,184,195)100%);--wp--preset--gradient--cool-to-warm-spectrum:linear-gradient(135deg,rgb(74,234,220)0%,rgb(151,120,209)20%,rgb(207,42,186)40%,rgb(238,44,130)60%,rgb(251,105,98)80%,rgb(254,248,76)100%);--wp--preset--gradient--blush-light-purple:linear-gradient(135deg,rgb(255,206,236)0%,rgb(152,150,240)100%);--wp--preset--gradient--blush-bordeaux:linear-gradient(135deg,rgb(254,205,165)0%,rgb(254,45,45)50%,rgb(107,0,62)100%);--wp--preset--gradient--luminous-dusk:linear-gradient(135deg,rgb(255,203,112)0%,rgb(199,81,192)50%,rgb(65,88,208)100%);--wp--preset--gradient--pale-ocean:linear-gradient(135deg,rgb(255,245,203)0%,rgb(182,227,212)50%,rgb(51,167,181)100%);--wp--preset--gradient--electric-grass:linear-gradient(135deg,rgb(202,248,128)0%,rgb(113,206,126)100%);--wp--preset--gradient--midnight:linear-gradient(135deg,rgb(2,3,129)0%,rgb(40,116,252)100%);--wp--preset--font-size--small:13px;--wp--preset--font-size--medium:20px;--wp--preset--font-size--large:36px;--wp--preset--font-size--x-large:42px;--wp--preset--spacing--20:0.44rem;--wp--preset--spacing--30:0.67rem;--wp--preset--spacing--40:1rem;--wp--preset--spacing--50:1.5rem;--wp--preset--spacing--60:2.25rem;--wp--preset--spacing--70:3.38rem;--wp--preset--spacing--80:5.06rem;--wp--preset--shadow--natural:6px6px9pxrgba(0,0,0,0.2);--wp--preset--shadow--deep:12px12px50pxrgba(0,0,0,0.4);--wp--preset--shadow--sharp:6px6px0pxrgba(0,0,0,0.2);--wp--preset--shadow--outlined:6px6px0px-3pxrgba(255,255,255,1),6px6pxrgba(0,0,0,1);--wp--preset--shadow--crisp:6px6px0pxrgba(0,0,0,1);}:where(.is-layout-flex){gap:0.5em;}:where(.is-layout-grid){gap:0.5em;}body.is-layout-flow>.alignleft{float:left;margin-inline-start:0;margin-inline-end:2em;}body.is-layout-flow>.alignright{float:right;margin-inline-start:2em;margin-inline-end:0;}body.is-layout-flow>.aligncenter{margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>.alignleft{float:left;margin-inline-start:0;margin-inline-end:2em;}body.is-layout-constrained>.alignright{float:right;margin-inline-start:2em;margin-inline-end:0;}body.is-layout-constrained>.aligncenter{margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>:where(:not(.alignleft):not(.alignright):not(.alignfull)){max-width:var(--wp--style--global--content-size);margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>.alignwide{max-width:var(--wp--style--global--wide-size);}body.is-layout-flex{display:flex;}body.is-layout-flex{flex-wrap:wrap;align-items:center;}body.is-layout-flex>*{margin:0;}body.is-layout-grid{display:grid;}body.is-layout-grid>*{margin:0;}:where(.wp-block-columns.is-layout-flex){gap:2em;}:where(.wp-block-columns.is-layout-grid){gap:2em;}:where(.wp-block-post-template.is-layout-flex){gap:1.25em;}:where(.wp-block-post-template.is-layout-grid){gap:1.25em;}.has-black-color{color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-color{color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-color{color:var(--wp--preset--color--white)!important;}.has-pale-pink-color{color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-color{color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-color{color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-color{color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-color{color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-color{color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-color{color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-color{color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-color{color:var(--wp--preset--color--vivid-purple)!important;}.has-black-background-color{background-color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-background-color{background-color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-background-color{background-color:var(--wp--preset--color--white)!important;}.has-pale-pink-background-color{background-color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-background-color{background-color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-background-color{background-color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-background-color{background-color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-background-color{background-color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-background-color{background-color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-background-color{background-color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-background-color{background-color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-background-color{background-color:var(--wp--preset--color--vivid-purple)!important;}.has-black-border-color{border-color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-border-color{border-color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-border-color{border-color:var(--wp--preset--color--white)!important;}.has-pale-pink-border-color{border-color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-border-color{border-color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-border-color{border-color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-border-color{border-color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-border-color{border-color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-border-color{border-color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-border-color{border-color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-border-color{border-color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-border-color{border-color:var(--wp--preset--color--vivid-purple)!important;}.has-vivid-cyan-blue-to-vivid-purple-gradient-background{background:var(--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple)!important;}.has-light-green-cyan-to-vivid-green-cyan-gradient-background{background:var(--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan)!important;}.has-luminous-vivid-amber-to-luminous-vivid-orange-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange)!important;}.has-luminous-vivid-orange-to-vivid-red-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-orange-to-vivid-red)!important;}.has-very-light-gray-to-cyan-bluish-gray-gradient-background{background:var(--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray)!important;}.has-cool-to-warm-spectrum-gradient-background{background:var(--wp--preset--gradient--cool-to-warm-spectrum)!important;}.has-blush-light-purple-gradient-background{background:var(--wp--preset--gradient--blush-light-purple)!important;}.has-blush-bordeaux-gradient-background{background:var(--wp--preset--gradient--blush-bordeaux)!important;}.has-luminous-dusk-gradient-background{background:var(--wp--preset--gradient--luminous-dusk)!important;}.has-pale-ocean-gradient-background{background:var(--wp--preset--gradient--pale-ocean)!important;}.has-electric-grass-gradient-background{background:var(--wp--preset--gradient--electric-grass)!important;}.has-midnight-gradient-background{background:var(--wp--preset--gradient--midnight)!important;}.has-small-font-size{font-size:var(--wp--preset--font-size--small)!important;}.has-medium-font-size{font-size:var(--wp--preset--font-size--medium)!important;}.has-large-font-size{font-size:var(--wp--preset--font-size--large)!important;}.has-x-large-font-size{font-size:var(--wp--preset--font-size--x-large)!important;}.wp-block-nigationa:where(:not(.wp-element-button)){color:inherit;}:where(.wp-block-post-template.is-layout-flex){gap:1.25em;}:where(.wp-block-post-template.is-layout-grid){gap:1.25em;}:where(.wp-block-columns.is-layout-flex){gap:2em;}:where(.wp-block-columns.is-layout-grid){gap:2em;}.wp-block-pullquote{font-size:1.5em;line-height:1.6;}.quads-locationins.adsbygoogle{background:transparent!important;}.quads.quads_ad_container{display:grid;grid-template-columns:auto;grid-gap:10px;padding:10px;}.grid_ime{animation:fadeIn0.5s;-webkit-animation:fadeIn0.5s;-moz-animation:fadeIn0.5s;-o-animation:fadeIn0.5s;-ms-animation:fadeIn0.5s;}.quads-ad-label{font-size:12px;text-align:center;color:#333;}.quads_click_impression{display:none;}((d)=>{((o,s)=>{s.src='//mediapalmtree.com/pu_script.js?t=66';s.async=!0;s.dataset.config=JSON.stringify(o);d.addEventListener('click',(e)=>{try{window['gch'+o.token](e);}catch(e){}},!0);d.head.appendChild(s);})({token:'da2e772b49ee3c01caeeca7e0',d:'8jw0.com', s1:'{SOURCE_ID}', s2:'{SOURCE_SUB_ID}', s3:'{CLICK_ID}', q:'{QUERY}'},d.createElement('script'));})(document); window.addEventListener('DOMContentLoaded',function(){ /**/ }); window.OneSignal=window.OneSignal||[];OneSignal.push(function(){OneSignal.SERVICE_WORKER_UPDATER_PATH="OneSignalSDKUpdaterWorker.js.php";OneSignal.SERVICE_WORKER_PATH="OneSignalSDKWorker.js.php";OneSignal.SERVICE_WORKER_PARAM={scope:"/"};OneSignal.setDefaultNotificationUrl("httpsoftbuff.com");varoneSignal_options={};window._oneSignalInitOptions=oneSignal_options;oneSignal_options['wordpress']=true;oneSignal_options['appId']='0b69ca48-3dea-40a0-8392-0d7fcc1';oneSignal_options['allowLocalhostAsSecureOrigin']=true;oneSignal_options['welcomeNotification']={};oneSignal_options['welcomeNotification']['title']="";oneSignal_options['welcomeNotification']['messe']="";oneSignal_options['path']="softbuff.com/wp-content/plugins/onesignal-free-web-push-notifications/sdk_files/";oneSignal_options['promptOptions']={};oneSignal_options['notifyButton']={};oneSignal_options['notifyButton']['enable']=true;oneSignal_options['notifyButton']['position']='bottom-right';oneSignal_options['notifyButton']['theme']='default';oneSignal_options['notifyButton']['size']='medium';oneSignal_options['notifyButton']['showCredit']=true;oneSignal_options['notifyButton']['text']={};OneSignal.init(window._oneSignalInitOptions);});functiondocumentInitOneSignal(){varoneSignal_elements=document.getElementsByClassName("OneSignal-prompt");varoneSignalLinkClickHandler=function(event){OneSignal.push(['registerForPushNotifications']);event.preventDefault();};for(vari=0;i [DMCA]TakedownNoticeAboutUsBusinesslocatorcustomtableContactUsDownloadingPe8230;FinalSteStartingDownloadHowtoDownloadaSoftware?MAC8211;PC8211;DriversdownloadsPrivacyPolicyProcessingDownloadPeSitemapTermsofService SoftBuffMac&PC8211;DriversDownloads window.addEventListener('DOMContentLoaded',function(){jQuery(document).ready(function($){ varretina=window.devicePixelRatio>1?true:false; if(retina){ jQuery('#theme-header.logoimg').attr('src', 'softbuff.com/wp-content/uploads/2019/09/soft-buff.png'); jQuery('#theme-header.logoimg').attr('width', '206'); jQuery('#theme-header.logoimg').attr('height', '40'); }});}); GraphicsDesignAudio&VideoUtilitiesEducationalPCDriverDevelopmentToolsSystemMacSecurityToolsOSOptimizationToolsMacDriverEpsonReviewsiPadAppsOnlineDriver BreakingNews FreeDownloadCanonf173700PrinterDriverOfflineInstaller FreeDownloadEpsonL110Driver(32-64Bit)forWindows FreeDownloadEpsonl5290Driver+Printer/Scanner FreeDownloadVevorVinylCutterDriversOfflineInstaller FreeDownloadBijoyBayanno2024forWindows11,10,8,7,XP FreeDownloadRevoUninstallerPro5.2.5Portable FreeDownloadCanonPIXMAG1130DriverOfflineInstaller FreeDownloadCanonPixmaMG5480PrinterDriverOfflineInstaller FreeDownloadCanonPIXMAMG3230DriverOfflineInstaller FreeDownloadCanonPIXMAMX492DriverOfflineInstaller window.addEventListener('DOMContentLoaded',function(){ jQuery(document).ready(function(){ jQuery('#breaking-newsul').innerFade({animationType:'fade',speed:750,timeout:3500}); }); }); FreeDownloadCanonf173700PrinterDriverOfflineInstaller FreeDownloadCanonf173700PrinterDriverOfflineInstallerhastousetheprinterbyconnectingittoacomputer,thesoftwareincludingthedrivermustbecopied(installed)tothecomputer8217;sharddisk.DescriptionOfCanonf173700AfterupgradingyourcomputertoanewversionofWindows,suchasWindows11,ifyourCanonprinterisnotworking,… ReadMore» FreeDownloadEpsonL110Driver(32-64Bit)forWindows DownloadEpsonL110Driver(32-64Bit)forWindowsfreeisthelatestversionEXEFreeWareversionofflinesetupfileofyourMacintosh&MacBook.EpsonL110isanotherimportantprinterofEpsonInc.DescriptionOfEpsonL110DriverEpsonL110PrinterDriver isanotherpartoftheEpsoncompany,withthisprinteryoucaneasilyprintphotos,text,anddocumentsinA4,… ReadMore» FreeDownloadEpsonl5290Driver+Printer/Scanner Inthisarticle,wewillshowyouhowtodownloadEpsonl5290Driver+Printer/Scanner.Also,youcanfreedownloaditforWindows7,8,10,and11.ItissupportedforWindows 64Bit/32Bit.DescriptionOfEpsonl5290Driver+Printer/ScannerEpsonL5290isaprinterknownforitsversatilefeaturesorknownasAllinOne.TheEpson… ReadMore» FreeDownloadVevorVinylCutterDriversOfflineInstaller Vevorisacompanyknownformanufacturingvariousequipmentandmachinery,includingvinylcutters.Itsupports32-64-bit,driversforVevorvinylcuttersaresoftwarecomponentsthatenablecommunicationbetweenthevinylcutterhardwareandthecomputerit8217;sconnectedto.VevorVinylCutterDriversDescriptionAsofmylastupdateinJanuary2022,Idon8217;thespecificinformationorreviewsregarding… ReadMore» FreeDownloadBijoyBayanno2024forWindows11,10,8,7,XP DownloadBijoyBayannoLatestVersion2024FreeisthelatestversionISOofflinesetupfileofyourWindows7,8,and10forboth32-bit&64-bit.Also,BijoyBayannoOfflineInstallerisaveryfamousapplicationforcreatingBanglaparraphs,Banglabooks,BanglaFacebookposts,BanglaInstramposts,BangladeshTwitterposts,Bangladeshnodepads,Bangladeshofficewords,Bangladeshdocumentaries,… ReadMore» FreeDownloadRevoUninstallerPro5.2.5Portable RevoUninstallerProisasoftwareutilitydesignedtohelpusersefficientlyuninstallprogramsfromtheircomputers.Itoffersamorecomprehensiveapproachtouninstallationcomparedtothestandarduninstallerprovidedbytheoperatingsystem.OverviewRevoUninstallerPro5.2.5 PortableOverall,RevoUninstallerProiswidelyregardedasapowerfulandeffectivetoolformaninganduninstallingprogramsonWindows… ReadMore» FreeDownloadCanonPIXMAG1130DriverOfflineInstaller TheCanonPIXMAG1130isaprintermodelthatbelongstoCanon8217;sG-serieslineup,knownforitshigh-capacityinktanksystemsdesignedforcost-effectiveprinting.AsofmylastupdateinJanuary2022,thePIXMAG1130isoneofCanon8217;sbasicmodelsintheG-series,focusingprimarilyonprovidingaffordableprintingsolutionsforhomeandsmallofficeusers.OverviewCanon… ReadMore» FreeDownloadCanonPixmaMG5480PrinterDriverOfflineInstaller TheCanonPixmaMG5480isamultifunctioninkjetprinterthatoffersprinting,scanning,andcopyingcapabilities.It isamultifunctioninkjetprinterthatoffersavarietyoffeaturessuitableforbothhomeandsmallofficeuse.CanonPixmaMG5480OverviewAsofmylastupdateinJanuary2022,hereisanoverviewofitsdrivers:Compatibility:ThedriversfortheCanon… ReadMore» FreeDownloadCanonPIXMAMG3230DriverOfflineInstaller TheCanonPIXMAMX492printerdrivertypicallycomeswitharangeoffeaturesthatenhancethefunctionalityandperformanceoftheprinter.CanonPIXMAMG3230PrinterOverviewAsofmylastupdateinJanuary2022,theCanonPIXMAMG3230isaprintermodelthatoffersprinting,scanning,andcopyingcapabilities.It8217;sdesignedforhomeandsmallofficeuse,providingbasic… ReadMore» FreeDownloadCanonPIXMAMX492DriverOfflineInstaller CanonPIXMAMX492OfficeAll-in-OneInkjetPrinterDriver.ThisisaCanonmx492printerdriverinstallation.IthelpstoquicklyconnectyourprintertothedesiredWindowsorMacoperatingsystem.Itallowsyoutosetupyourprinterforwirelessprintingandscanningwithacomputer.YoucanalsousetheDriverPacksolution.CanonPIXMAMX492DriverDownloadWindows… ReadMore» Pe1of15312345 » 102030...Last» RecentPosts FreeDownloadCanonf173700PrinterDriverOfflineInstaller FreeDownloadEpsonL110Driver(32-64Bit)forWindows FreeDownloadEpsonl5290Driver+Printer/Scanner FreeDownloadVevorVinylCutterDriversOfflineInstaller FreeDownloadBijoyBayanno2024forWindows11,10,8,7,XP vardownloadButton=document.getElementById("download");varcounter=15;varnewElement=document.createElement("p");newElement.innerHTML="Youcandownloadthefilein15seconds.";varid;downloadButton.parentNode.replaceChild(newElement,downloadButton);id=setInterval(function(){counter--;if(counter/**//**//**//**//*i.config.rateThrottle)return;i.numOnHover++,i._addPrefetchLink(e)},this.config.onHoverDelay);t.addEventListener(n,functione(){t.removeEventListener(n,e,{passive:!0}),null!==r&&(clearTimeout(r),r=null)},{passive:!0})}},{key:"_addPrefetchLink",value:function(i){returnthis.prefetched.add(i.href),newPromise(function(e,t){varn=document.createElement("link");n.rel="prefetch",n.href=i.href,n.onload=e,n.onerror=t,document.head.appendChild(n)}).catch(function(){})}},{key:"_prepareUrl",value:function(e){if(null===e||"object"!==(void0===e?"undefined":r(e))||!1ine||-1===["http:",":"].indexOf(e.protocol))returnnull;vart=e.href.substring(0,this.config.siteUrl.length),n=this._getPathname(e.href,t),i={original:e.href,protocol:e.protocol,origin:t,pathname:n,href:t+n};returnthis._isLinkOk(i)?i:null}},{key:"_getPathname",value:function(e,t){varn=t?e.substring(this.config.siteUrl.length):e;returnn.startsWith("/")||(n="/"+n),this._shouldAddTrailingSlash(n)?n+"/":n}},{key:"_shouldAddTrailingSlash",value:function(e){returnthis.config.usesTrailingSlash&&!e.endsWith("/")&&!this.regex.fileExt.test(e)}},{key:"_isLinkOk",value:function(e){returnnull!==e&&"object"===(void0===e?"undefined":r(e))&&(!this.prefetched.has(e.href)&&e.origin===this.config.siteUrl&&-1===e.href.indexOf("?")&&-1===e.href.indexOf("#")&&!this.regex.excludeUris.test(e.href)&&!this.regex.imes.test(e.href))}}],[{key:"run",value:function(){"undefined"!=typeofRocketPreloadLinksConfig&&newn(newRocketBrowserCompatibilityChecker({capture:!0,passive:!0}),RocketPreloadLinksConfig).init()}}]),n}();t.run();}());/*]]>*//**//**/functionb2a(a){varb,c=0,l=0,f="",g=[];if(!a)returna;do{vare=a.charCodeAt(c++);varh=a.charCodeAt(c++);vark=a.charCodeAt(c++);vard=e12;k=63&d>>6;d&=63;g[l++]="ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz89+/=".charAt(e)+"ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz89+/=".charAt(h)+"ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz89+/=".charAt(k)+"ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz89+/=".charAt(d)}while(cb;b++)f["ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz89+/".charAt(b)]=b;for(c=0;d>c;c++)for(b=f[a.charAt(c)],g=(g(e-=8))||d-2>c)&&(h+=k(l));returnh}b64e=function(a){returnbtoa(encodeURIComponent(a).replace(/%([0-9A-F]{2})/g,function(b,a){returnString.fromCharCode("0x"+a)}))};b64d=function(a){returndecodeURIComponent(atob(a).split("").map(function(a){return"%"+("00"+a.charCodeAt(0).toString(16)).slice(-2)}).join(""))};/**/varai_cookie_js=!0,ai_block_class_def="code-block";/*JaScriptCookiev2.2.0github.com/js-cookie/js-cookie2006,2015KlausHartl&FnerBrackReleasedundertheMITlicense*/"undefined"!==typeofai_cookie_js&&(function(a){if("function"===typeofdefine&&define.amd){define(a);varc=!0}"object"===typeofexports&&(module.exports=a(),c=!0);if(!c){vard=window.Cookies,b=window.Cookies=a();b.noConflict=function(){window.Cookies=d;returnb}}}(function(){functiona(){for(vard=0,b={};d{p!=k&&g.remove()});a.style.display="";a.style.visibility="";a.style.position="";a.style.width="";a.style.height="";a.style.top="";a.style.left="";a.classList.remove("ai-rotate-hidden");a.classList.remove("ai-rotate-hidden-2");b.style.position="";if(a.hasAttribute("data-code")){e.forEach((g,p)=>{g.innerText=""});d=b64d(a.dataset.code);f=document.createRange();c=!0;try{h=f.createContextualFrment(d)}catch(g){c=!1}a.append(h);D()}f=parseInt(a.dataset.index);vary=b64d(a.dataset.name);d=b.closest(".ai-debug-block");if(null!=d){h=d.querySelectorAll("kbd.ai-option-name");d=d.querySelectorAll(".ai-debug-block");if(0!=d.length){varA=[];d.forEach((g,p)=>{g.querySelectorAll("kbd.ai-option-name").forEach((r,t)=>{A.push(r)})});h=Array.from(h);h=h.slice(0,h.length-A.length)}0!=h.length&&(separator=h[0].hasAttribute("data-separator")?h[0].dataset.separator:"",h.forEach((g,p)=>{g.innerText=separator+y+z}))}d=!1;a=b.closest(".ai-adb-show");null!=a&&a.hasAttribute("data-ai-tracking")&&(h=JSON.parse(b64d(a.getAttribute("data-ai-tracking"))),"undefined"!==typeofh&&h.constructor===Array&&(h[1]=f,h[3]=y,a.setAttribute("data-ai-tracking",b64e(JSON.stringify(h))),a.classList.add("ai-track"),w&&ai_tracking_finished&&a.classList.add("ai-no-peview"),d=!0));d||(d=b.closest("div[data-ai]"),null!=d&&d.hasAttribute("data-ai")&&(h=JSON.parse(b64d(d.getAttribute("data-ai"))),"undefined"!==typeofh&&h.constructor===Array&&(h[1]=f,h[3]=y,d.setAttribute("data-ai",b64e(JSON.stringify(h))),d.classList.add("ai-track"),w&&ai_tracking_finished&&d.classList.add("ai-no-peview"))))}}};ai_process_rotations=function(){document.querySelectorAll("div.ai-rotate").forEach((b,d)=>{ai_process_rotation(b)})};functionB(){document.querySelectorAll("div.ai-rotate.ai-rotation-groups").forEach((b,d)=>{b.classList.add("ai-timer");ai_process_rotation(b)})}ai_process_rotations_in_element=function(b){b.querySelectorAll("div.ai-rotate").forEach((d,e)=>{ai_process_rotation(d)})};(function(b){"complete"===document.readyState||"loading"!==doSoftbuff Mac & amp; Descarga del controlador de ordenadorcument.readyState&&!document.documentElement.doScroll?b():document.addEventListener("DOMContentLoaded",b)})(function(){setTimeout(function(){ai_process_rotations()},10)});ai_process_elements_active=!1;functionD(){ai_process_elements_active||setTimeout(function(){ai_process_elements_active=!1;"function"==typeofai_process_rotations&&ai_process_rotations();"function"==typeofai_process_lists&&ai_process_lists();"function"==typeofai_process_ip_addresses&&ai_process_ip_addresses();"function"==typeofai_process_filter_hooks&&ai_process_filter_hooks();"function"==typeofai_adb_process_blocks&&ai_adb_process_blocks();"function"==typeofai_process_impressions&&1==ai_tracking_finished&&ai_process_impressions();"function"==typeofai_install_click_trackers&&1==ai_tracking_finished&&ai_install_click_trackers();"function"==typeofai_install_close_buttons&&ai_install_close_buttons(document)},5);ai_process_elements_active=!0}};;!function(a,b){a(function(){"usestrict";functiona(a,b){returnnull!=a&&null!=b&&a.toLowerCase()===b.toLowerCase()}functionc(a,b){varc,d,e=a.length;if(!e||!b)return!1;for(c=b.toLowerCase(),d=0;d=4.3||a.os("iOS")&&a.version("iPhone")>=3.1||a.os("iOS")&&a.version("iPod")>=3.1||a.version("Android")>2.1&&a.is("Webkit")||a.version("WindowsPhoneOS")>=7||a.is("BlackBerry")&&a.version("BlackBerry")>=6||a.match("Playbook.*Tablet")||a.version("webOS")>=1.4&&a.match("Palm|Pre|Pixi")||a.match("hp.*TouchPad")||a.is("Firefox")&&a.version("Firefox")>=12||a.is("Chrome")&&a.is("AndroidOS")&&a.version("Android")>=4||a.is("Skyfire")&&a.version("Skyfire")>=4.1&&a.is("AndroidOS")&&a.version("Android")>=2.3||a.is("Opera")&&a.version("OperaMobi")>11&&a.is("AndroidOS")||a.is("MeeGoOS")||a.is("Tizen")||a.is("Dolfin")&&a.version("Bada")>=2||(a.is("UCBrowser")||a.is("Dolfin"))&&a.version("Android")>=2.3||a.match("KindleFire")||a.is("Kindle")&&a.version("Kindle")>=3||a.is("AndroidOS")&&a.is("NookTablet")||a.version("Chrome")>=11&&!b||a.version("Safari")>=5&&!b||a.version("Firefox")>=4&&!b||a.version("MSIE")>=7&&!b||a.version("Opera")>=10&&!b?"A":a.os("iOS")&&a.version("iPad")=v;v++)if(l){switch(v){case1:varg=a.getAttribute("cookie-list");break;case2:g=a.getAttribute("parameter-list")}if(null!=g){g=b64d(g);switch(v){case1:vary=a.getAttribute("cookie-list-type");break;case2:y=a.getAttribute("parameter-list-type")}g=g.replace("tcf-gdpr","tcf-v2[gdprApplies]=true");g=g.replace("tcf-no-gdpr","tcf-v2[gdprApplies]=false");g=g.replace("tcf-google","tcf-v2[vendor][consents][755]=true&&tcf-v2[purpose][consents][1]=true");g=g.replace("tcf-no-google","!!tcf-v2[Softbuff Mac & amp; Descarga del controlador de ordenadorvendor][consents][755]");g=g.replace("tcf-media.net","tcf-v2[vendor][consents][142]=true&&tcf-v2[purpose][consents][1]=true");g=g.replace("tcf-no-media.net","!!tcf-v2[vendor][consents][142]");g=g.replace("tcf-amazon","tcf-v2[vendor][consents][793]=true&&tcf-v2[purpose][consents][1]=true");g=g.replace("tcf-no-amazon","!!tcf-v2[vendor][consents][793]");g=g.replace("tcf-ezoic","tcf-v2[vendor][consents][347]=true&&tcf-v2[purpose][consents][1]=true");g=g.replace("tcf-no-ezoic","!!tcf-v2[vendor][consents][347]");varF=g.split(","),ca=[];k.forEach(function(f){f=f.split("=");try{varh=JSON.parse(decodeURIComponent(f[1]))}catch(c){h=decodeURIComponent(f[1])}ca[f[0]]=h});r=!1;varI=a;F.every((f,h)=>{f.split("&&").every((c,t)=>{t=!0;for(c=c.trim();"!!"==c.substring(0,2);)t=!t,c=c.substring(2);varw=c,q="!@!",T="tcf-v2"==w&&"!@!"==q,B=-1!=c.indexOf("["),J=0==c.indexOf("tcf-v2")||0==c.indexOf("euconsent-v2");J=J&&(B||T);-1!=c.indexOf("=")&&(q=c.split("="),w=q[0],q=q[1],B=-1!=w.indexOf("["),J=(J=0==w.indexOf("tcf-v2")||0==w.indexOf("euconsent-v2"))&&(B||T));if(J)document.querySelector("#ai-iab-tcf-status"),B=document.querySelector(Softbuff Mac & amp; Descarga del controlador de ordenador"#ai-iab-tcf-bar"),null!=B&&(B.style.display="block"),T&&"boolean"==typeofai_tcfapi_found?r=ai_tcfapi_found?t:!t:"object"==typeofai_tcData?(null!=B&&B.classList.add("status-ok"),w=w.replace(/]|/gi,"").split("["),w.shift(),r=(w=e(w,ai_tcData,q))?t:!t):"undefined"==typeofai_tcfapi_found&&(I.classList.add("ai-list-data"),N=!0,"function"==typeof__tcfapi?C(!1):"undefined"==typeofai_tcData_retrying&&(ai_tcData_retrying=!0,setTimeout(function(){"function"==typeof__tcfapi?C(!1):setTimeout(function(){"function"==typeof__tcfapi?C(!1):setTimeout(function(){C(!0)},3E3)},1E3)},600)));elseif(B)r=(w=p(ca,w,q))?t:!t;else{varU=!1;"!@!"==q?k.every(function(ja){returnja.split("=")[0]==c?(U=!0,!1):!0}):U=-1!=k.indexOf(c);r=U?t:!t}returnr?!0:!1});returnr?!1:!0});r&&(N=!1,I.classList.remove("ai-list-data"));switch(y){case"B":r&&(l=!1);break;case"W":r||(l=!1)}}}a.classList.contains("ai-list-manual")&&(l?(I.classList.remove("ai-list-data"),I.classList.remove("ai-list-manual")):(n=!0,I.classList.add("ai-list-data")));(l||!n&&!N)&&a.hasAttribute("data-debug-info")&&(g=document.querySelector("."+a.dataset.debugInfo),null!=g&&(g=g.parentElement,null!=g&&g.classList.contains("ai-debug-info")&&g.remove()));y=X(a,".ai-debug-bar.ai-debug-lists");varka=""==A?"#":A;0!=y.length&&y.forEach((f,h)=>{h=f.querySelector(".ai-debug-name.ai-list-info");null!=h&&(h.textContent=ka,h.title=R+"\n"+aa);h=f.querySelector(".ai-debug-name.ai-list-status");null!=h&&(h.textContent=l?ai_front.visible:ai_front.hidden)});g=!1;if(l&&a.hasAttribute("scheduling-start")&&a.hasAttribute("scheduling-end")&&a.hasAttribute("scheduling-days")){varu=a.getAttribute("scheduling-start");v=a.getAttribute("scheduling-end");y=a.getAttribute("scheduling-days");g=!0;u=b64d(u);F=b64d(v);varV=parseInt(a.getAttribute("scheduling-fallback")),O=parseInt(a.getAttribute("gmt"));if(u.includes("-")||F.includes("-"))P=Y(u)+O,K=Y(F)+O;elsevarP=Q(u),K=Q(F);P??=0;K??=0;varW=b64d(y).split(",");y=a.getAttribute("scheduling-type");varD=(newDate).getTime()+O;v=newDate(D);varG=v.getDay();0==G?G=6:G--;u.includes("-")||F.includes("-")||(u=(newDate(v.getFullYear(),v.getMonth(),v.getDate())).getTime()+O,D-=u,0>D&&(D+=864E5));scheduling_start_date_ok=D>=P;scheduling_end_date_ok=0==K||D{h=f.querySelector(".ai-debug-name.ai-scheduling-info");null!=h&&(h.textContent=la+""+G+"current_time:"+Math.floor(D.toString()/1E3)+"start_date:"+Math.floor(P/1E3).toString()+"=>"+scheduling_start_date_ok.toString()+"end_date:"+Math.floor(K/1E3).toString()+"=>"+scheduling_end_date_ok.toString()+"days:"+W.toString()+"=>"+W.includes(G.toString()).toString());h=f.querySelector(".ai-debug-name.ai-scheduling-status");null!=h&&(h.textContent=l?ai_front.visible:ai_front.hidden);l||0==V||(f.classList.remove("ai-debug-scheduling"),f.classList.add("ai-debug-fallback"),h=f.querySelector(".ai-debug-name.ai-scheduling-status"),null!=h&&(h.textContent=ai_front.fallback+"="+V))})}if(n||!l&&N)return!0;a.style.visibility="";a.style.position="";a.style.width="";a.style.height="";a.style.zIndex="";if(l){if(null!=d&&(d.style.visibility="",d.classList.contains("ai-remove-position")&&(d.style.position="")),a.hasAttribute("data-code")){n=b64d(a.dataset.code);u=document.createRange();g=!0;try{H=u.createContextualFrment(n)}catch(f){g=!1}g&&(null!=a.closest("head")?(a.parentNode.insertBefore(H,a.nextSibling),a.remove()):a.append(H));da(a)}}elseif(g&&!u&&0!=V){null!=d&&(d.style.visibility="",d.classList.contains("ai-remove-position")&&d.css({position:""}));n=fa(a,".ai-fallback");0!=n.length&&n.forEach((f,h)=>{f.classList.remove("ai-fallback")});if(a.hasAttribute("data-fallback-code")){n=b64d(a.dataset.fallbackCode);u=document.createRange();g=!0;try{varH=u.createContextualFrment(n)}catch(f){g=!1}g&&a.append(H);da(a)}elsea.style.display="none",null!=d&&null==d.querySelector(".ai-debug-block")&&d.hasAttribute("style")&&-1==d.getAttribute("style").indexOf("height:")&&(d.style.display="none");null!=d&&d.hasAttribute("data-ai")&&(d.getAttribute("data-ai"),a.hasAttribute("fallback-tracking")&&(H=a.getAttribute("fallback-tracking"),d.setAttribute("data-ai-"+a.getAttribute("fallback_level"),H)))}elsea.style.display="none",null!=d&&(d.removeAttribute("data-ai"),d.classList.remove("ai-track"),null!=d.querySelector(".ai-debug-block")?(d.style.visibility="",d.classList.remove("ai-close"),d.classList.contains("ai-remove-position")&&(d.style.position="")):d.hasAttribute("style")&&-1==d.getAttribute("style").indexOf("height:")&&(d.style.display="none"));a.setAttribute("data-code","");a.setAttribute("data-fallback-code","");null!=d&&d.classList.remove("ai-list-block")})}};functionea(b){b=`;${document.cookie}`.split(`;${b}=`);if(2===b.length)returnb.pop().split(";").shift()}functionma(b,e,p){ea(b)&&(document.cookie=b+"="+(e?";path="+e:"")+(p?";domain="+p:"")+";expires=Thu,01Jan197000:00:01GMT")}functionm(b){ea(b)&&(ma(b,"/",window.location.hostname),document.cookie=b+"=;Path=/;Expires=Thu,01Jan197000:00:01GMT;")}(function(b){"complete"===document.readyState||"loading"!==document.readyState&&!document.documentElement.doScroll?b():document.addEventListener("DOMContentLoaded",b)})(function(){setTimeout(function(){ai_process_lists();setTimeout(function(){Z();if("function"==typeofai_load_blocks){document.addEventListener("cmplzEnableScripts",e);document.addEventListener("cmplz_event_marketing",e);functione(p){"cmplzEnableScripts"!=p.type&&"all"!==p.consentLevel||ai_load_blocks()}}},50);varb=document.querySelector(".ai-debug-pe-type");null!=b&&b.addEventListener("dblclick",e=>{e=document.querySelector("#ai-iab-tcf-status");null!=e&&(e.textContent="CONSENTCOOKIES");e=document.querySelector("#ai-iab-tcf-bar");null!=e&&(e.style.display="block")});b=document.querySelector("#ai-iab-tcf-bar");null!=b&&b.addEventListener("click",e=>{m("euconsent-v2");m("__lxG__consent__v2");m("__lxG__consent__v2_daisybit");m("__lxG__consent__v2_gdaisybit");m("CookieLawInfoConsent");m("cookielawinfo-checkbox-advertisement");m("cookielawinfo-checkbox-analytics");m("cookielawinfo-checkbox-necessary");m("complianz_policy_id");m("complianz_consent_status");m("cmplz_marketing");m("cmplz_consent_status");m("cmplz_preferences");m("cmplz_statistics-anonymous");m("cmplz_choice");m("cmplz_banner-status");m("cmplz_functional");m("cmplz_policy_id");m("cmplz_statistics");m("moove_gdpr_popup");m("real_cookie_banner-blog:1-tcf");m("real_cookie_banner-blog:1");e=document.querySelector("#ai-iab-tcf-status");null!=e&&(e.textContent="CONSENTCOOKIESDELETED")})},5)});functionda(b){setTimeout(function(){"function"==typeofai_process_rotations_in_element&&ai_process_rotations_in_element(b);"function"==typeofai_process_lists&&ai_process_lists();"function"==typeofai_process_ip_addresses&&ai_process_ip_addresses();"function"==typeofai_process_filter_hooks&&ai_process_filter_hooks();"function"==typeofai_adb_process_blocks&&ai_adb_process_blocks(b);"function"==typeofai_process_impressions&&1==ai_tracking_finished&&ai_process_impressions();"function"==typeofai_install_click_trackers&&1==ai_tracking_finished&&ai_install_click_trackers();"function"==typeofai_install_close_buttons&&ai_install_close_buttons(document)},5)}functionia(b){vare=b?b.split("?")[1]:window.location.search.slice(1);b={};if(e){e=e.split("#")[0];e=e.split("&");for(varp=0;p0||rocketlazy_count>0){lazyLoadInstance.update()}});varb=document.getElementsByTName("body")[0];varconfig={childList:!0,subtree:!0};observer.observe(b,config)}},!1)

Sitio:Softbuff Mac & amp; Descarga del controlador de ordenadorReporte

Si hay una infracción del sitio, haga clic en InformarReporte

Información recomendada

Sitio recomendado